PDB entry 1w4u

View 1w4u on RCSB PDB site
Description: nmr solution structure of the ubiquitin conjugating enzyme ubch5b
Class: ligase
Keywords: ubiquitination, e2 enzyme, ligase, bl conjugation pathway
Deposited on 2004-07-29, released 2004-11-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2-17 kda 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1w4ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w4uA (A:)
    malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
    pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
    peiariyktdrekynriarewtqkyam