PDB entry 1w4t

View 1w4t on RCSB PDB site
Description: x-ray crystallographic structure of pseudomonas aeruginosa arylamine n-acetyltransferase
Class: transferase
Keywords: arylamine n-acetyltransferase, pseudomonas aeruginosa, 5-aminosalicylic acid, nat, xenobiotic metabolism, acyltransferase
Deposited on 2004-07-29, released 2005-08-03
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arylamine n-acetyltransferase
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w4ta1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4tA (A:)
    mgsshhhhhhssglvprgshmtpltpeqthaylhhigiddpgppslanldrlidahlrrv
    afenldvlldrpieidadkvfakvvegsrggycfelnslfarlllalgyelellvarvrw
    glpddapltqqshlmlrlylaegeflvdvgfgsanppralplpgdeadagqvhcvrlvdp
    haglyesavrgrsgwlplyrfdlrpqlwidyiprnwytsthphsvfrqglkaaitegdlr
    ltladglfgqragngetlqrqlrdveelldilqtrfrlrldpasevpalarrlaglisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4tA (A:)
    hmtpltpeqthaylhhigiddpgppslanldrlidahlrrvafenldvlldrpieidadk
    vfakvvegsrggycfelnslfarlllalgyelellvarvrwglpddapltqqshlmlrly
    laegeflvdvgfgsanppralplpgdeadagqvhcvrlvdphaglyesavrgrsgwlply
    rfdlrpqlwidyiprnwytsthphsvfrqglkaaitegdlrltladglfgqragngetlq
    rqlrdveelldilqtrfrlrldpasevpalarrlagli