PDB entry 1w4s

View 1w4s on RCSB PDB site
Description: crystal structure of the proximal bah domain of polybromo
Deposited on 2004-07-28, released 2005-04-27
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.201
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polybromo 1 protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w4sA (A:)
    hmssgsaglsslhrtysqdcsfknsmyhvgdyvyvepaeanlqphivcierlwedsagek
    wlygcwfyrpnetfhlatrkflekevfksdyynkvpvskilgkcvvmfvkeyfklcpenf
    rdedvyvcesrysaktksfkkiklwtmpvssvrfvprdvplpvvrvasvfantd
    

    Sequence, based on observed residues (ATOM records):
    >1w4sA (A:)
    myhvgdyvyvepaeanlqphivcierlwedsagekwlygcwfyrpnetfhlatrkfleke
    vfksdyynkvpvskilgkcvvmfvkeyfklcpenfrdedvyvcesrysaktksfkkiklw
    tmpvssvrfvprdvplpvvrvasvfa