PDB entry 1w4r

View 1w4r on RCSB PDB site
Description: Structure of a type II thymidine kinase with bound dTTP
Class: transferase
Keywords: transferase, type II
Deposited on 2004-07-27, released 2005-02-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.16
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1w4ra1, d1w4ra2
  • Chain 'B':
    Compound: Thymidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1w4rb1, d1w4rb2
  • Chain 'C':
    Compound: Thymidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1w4rc1, d1w4rc2
  • Chain 'D':
    Compound: Thymidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1w4rd1, d1w4rd2
  • Chain 'E':
    Compound: Thymidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1w4re1, d1w4re2
  • Chain 'F':
    Compound: Thymidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1w4rf1, d1w4rf2
  • Chain 'G':
    Compound: Thymidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1w4rg1, d1w4rg2
  • Chain 'H':
    Compound: Thymidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1w4rh1, d1w4rh2
  • Heterogens: TTP, ZN, DTU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4rA (A:)
    mrgshhhhhhlvprgsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdt
    rysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktv
    ivaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaaytkrlgtekeveviggad
    kyhsvcrlcyfkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4rA (A:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
    acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
    nlvplaesvvkltavcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w4rB (B:)
    mrgshhhhhhlvprgsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdt
    rysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktv
    ivaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaaytkrlgtekeveviggad
    kyhsvcrlcyfkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4rB (B:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfmealpacllrdv
    aqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplae
    svvkltavcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w4rC (C:)
    mrgshhhhhhlvprgsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdt
    rysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktv
    ivaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaaytkrlgtekeveviggad
    kyhsvcrlcyfkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4rC (C:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
    avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklta
    vcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w4rD (D:)
    mrgshhhhhhlvprgsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdt
    rysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktv
    ivaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaaytkrlgtekeveviggad
    kyhsvcrlcyfkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4rD (D:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
    avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklta
    vcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w4rE (E:)
    mrgshhhhhhlvprgsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdt
    rysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktv
    ivaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaaytkrlgtekeveviggad
    kyhsvcrlcyfkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4rE (E:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
    avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklta
    vcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w4rF (F:)
    mrgshhhhhhlvprgsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdt
    rysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktv
    ivaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaaytkrlgtekeveviggad
    kyhsvcrlcyfkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4rF (F:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtryalpacllrdvaqealg
    vavigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt
    avcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w4rG (G:)
    mrgshhhhhhlvprgsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdt
    rysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktv
    ivaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaaytkrlgtekeveviggad
    kyhsvcrlcyfkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4rG (G:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
    avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklta
    vcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w4rH (H:)
    mrgshhhhhhlvprgsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdt
    rysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktv
    ivaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaaytkrlgtekeveviggad
    kyhsvcrlcyfkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4rH (H:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrealpacllrdvaqealg
    vavigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt
    avcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk