PDB entry 1w4m

View 1w4m on RCSB PDB site
Description: structure of the human pleckstrin dep domain by multidimensional nmr
Class: signal transduction
Keywords: dep domain, human pleckstrin
Deposited on 2004-07-26, released 2004-12-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-04, with a file datestamp of 2007-07-20.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1w4ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4mA (A:)
    petidlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsnqsvrnrqeglmi
    assllnegylqpagdmsksavdgtaenpfldnpdafyyfpdsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4mA (A:)
    dlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsnqsvrnrqeglmiassl
    lnegylqpagdmsksavdgtaenpfldnpdafyyf