PDB entry 1w4m

View 1w4m on RCSB PDB site
Description: structure of the human pleckstrin dep domain by multidimensional nmr
Class: signal transduction
Keywords: signal transduction, dep domain, human pleckstrin
Deposited on 2004-07-26, released 2004-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4mA (A:)
    petidlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsnqsvrnrqeglmi
    assllnegylqpagdmsksavdgtaenpfldnpdafyyfpdsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4mA (A:)
    dlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsnqsvrnrqeglmiassl
    lnegylqpagdmsksavdgtaenpfldnpdafyyf