PDB entry 1w4k

View 1w4k on RCSB PDB site
Description: Peripheral-subunit binding domains from mesophilic, thermophilic, and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions
Class: transferase
Keywords: ultrafast folding, transferase
Deposited on 2004-07-23, released 2005-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate dehydrogenase e2
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4K (0-1)
      • engineered mutation (21)
      • engineered mutation (41)
    • Uniprot Q8ZUR6 (2-50)
    Domains in SCOPe 2.07: d1w4ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w4kA (A:)
    gsrevaampaarrlakelgidaskvkgtgpggvitvedvkrwaeetakata