PDB entry 1w4i

View 1w4i on RCSB PDB site
Description: peripheral-subunit binding domains from mesophilic, thermophilic, and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions
Deposited on 2004-07-23, released 2005-07-20
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate dehydrogenase e2
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4I (0-1)
    • Uniprot Q8ZUR6 (2-61)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1w4iA (A:)
    gsrevaampaarrlakelgidlskvkgtgpggvitvedvkryaeetakatapapapkave
    ka