PDB entry 1w4c

View 1w4c on RCSB PDB site
Description: p4 protein from bacteriophage phi12 apo state
Class: hydrolase
Keywords: hydrolase, dsRNA virus, packaging ATPase, hexameric helicase, molecular motor, non-hydrolysable ATP analogue hydrolase
Deposited on 2004-07-22, released 2004-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2514
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4ca_
  • Chain 'B':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cb_
  • Chain 'C':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cc_
  • Chain 'D':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cd_
  • Chain 'E':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4ce_
  • Chain 'F':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cf_
  • Chain 'G':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cg_
  • Chain 'H':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4ch_
  • Chain 'I':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4ci_
  • Chain 'J':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cj_
  • Chain 'K':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4ck_
  • Chain 'L':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cl_
  • Chain 'M':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cm_
  • Chain 'N':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cn_
  • Chain 'O':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4co_
  • Chain 'P':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cp_
  • Chain 'Q':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cq_
  • Chain 'R':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cr_
  • Chain 'S':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cs_
  • Chain 'T':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4ct_
  • Chain 'U':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cu_
  • Chain 'V':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cv_
  • Chain 'W':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cw_
  • Chain 'X':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4cx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4cA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w4cB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w4cC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w4cD (D:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cD (D:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w4cE (E:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cE (E:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w4cF (F:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cF (F:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w4cG (G:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cG (G:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w4cH (H:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cH (H:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1w4cI (I:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cI (I:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1w4cJ (J:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cJ (J:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1w4cK (K:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cK (K:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1w4cL (L:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cL (L:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1w4cM (M:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cM (M:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1w4cN (N:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cN (N:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1w4cO (O:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cO (O:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1w4cP (P:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cP (P:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1w4cQ (Q:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cQ (Q:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1w4cR (R:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cR (R:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1w4cS (S:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cS (S:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1w4cT (T:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cT (T:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1w4cU (U:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cU (U:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1w4cV (V:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cV (V:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1w4cW (W:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cW (W:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1w4cX (X:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4cX (X:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk