PDB entry 1w4a

View 1w4a on RCSB PDB site
Description: P4 protein from PHI12 in complex with AMPcPP and Mn
Class: hydrolase
Keywords: virus dsRNA, packaging ATPase, hexameric helicase, molecular motor, non-hydrolysable ATP analogue, hydrolase
Deposited on 2004-07-22, released 2004-10-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w4aa_
  • Chain 'B':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w4ab_
  • Chain 'C':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w4ac_
  • Heterogens: APC, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4aA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4aA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndele
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w4aB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4aB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndele
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w4aC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4aC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndele