PDB entry 1w48

View 1w48 on RCSB PDB site
Description: P4 protein from Bacteriophage PHI12 in complex with AMPcPP
Class: hydrolase
Keywords: dsRNA virus, packaging ATPase, hexameric helicase, molecular motor, non-hydrolysable ATP analogue, hydrolase
Deposited on 2004-07-22, released 2004-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1638
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w48a_
  • Chain 'B':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w48b_
  • Chain 'C':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w48c_
  • Heterogens: APC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w48A (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w48A (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w48B (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w48B (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w48C (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w48C (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsqasgkaiqtvik
    ndel