PDB entry 1w47

View 1w47 on RCSB PDB site
Description: P4 protein from Bacteriophage PHI12 in complex with ADP and MN
Class: hydrolase
Keywords: hydrolase, dsRNA virus, packaging ATPase, hexameric helicase, molecular motor, non-hydrolysable ATP analogue
Deposited on 2004-07-22, released 2004-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w47a_
  • Chain 'B':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w47b_
  • Chain 'C':
    Compound: ntpase p4
    Species: BACTERIOPHAGE PHI-12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w47c_
  • Heterogens: ADP, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w47A (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w47A (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w47B (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w47B (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihts
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w47C (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w47C (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihts