PDB entry 1w40

View 1w40 on RCSB PDB site
Description: t. celer l30e k9a variant
Class: ribosomal protein
Keywords: ribosomal protein, electrostatic interactions, thermostability, protein engineering
Deposited on 2004-07-22, released 2005-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l30e
    Species: THERMOCOCCUS CELER [TaxId:2264]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29160 (0-End)
      • engineered mutation (9)
    Domains in SCOPe 2.07: d1w40a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w40A (A:)
    mvdfafelraaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgip
    vyefegtsvelgtllgrphtvsalavvdpgesrilalggke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w40A (A:)
    mvdfafelraaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgip
    vyefegtsvelgtllgrphtvsalavvdpgesrilalg