PDB entry 1w3y

View 1w3y on RCSB PDB site
Description: crystal structure of s. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin c
Class: lyase
Keywords: (alfa5/alfa5) barrel, lyase, peptidoglycan-anchor
Deposited on 2004-07-21, released 2004-08-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.1924
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronate lyase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54873
      • conflict (28)
    • PDB 1W3Y
    Domains in SCOPe 2.05: d1w3ya1, d1w3ya2, d1w3ya3
  • Heterogens: PVC, XYL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3yA (A:)
    asvkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwe
    kfsnyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksi
    vgnwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalg
    gnlvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytga
    ygnvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisra
    nseghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmq
    sllsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgw
    ytsdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskld
    danatatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpy
    kvyvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdin
    egqsdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsv
    ydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevf
    kkleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3yA (A:)
    vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
    snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
    nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
    lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
    nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
    eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
    lsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyt
    sdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskldda
    natatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykv
    yvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdineg
    qsdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvyd
    akqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkk
    l