PDB entry 1w3w

View 1w3w on RCSB PDB site
Description: the 2.1 angstroem resolution structure of annexin a8
Class: coagulation
Keywords: coagulation, annexin family, calcium and phospholipid binding proteins
Deposited on 2004-07-20, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin a8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3wa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3wA (A:)
    mawwkawieqegvtvkssshfnpdpdaetlykamkgigtneqaiidvltkrsntqrqqia
    ksfkaqfgkdltetlkselsgkferlivalmyppyryeakelhdamkglgtkegviieil
    asrtknqlreimkayeedygssleediqadtsgylerilvcllqgsrddvssfvdpalal
    qdaqdlyaagekirgtdemkfitilctrsathllrvfeeyekianksiedsiksethgsl
    eeamltvvkctqnlhsyfaerlyyamkgagtrdgtlirnivsrseidlnlikchfkkmyg
    ktlssmimedtsgdyknallslvgsdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3wA (A:)
    ssshfnpdpdaetlykamkgigtneqaiidvltkrsntqrqqiaksfkaqfgkdltetlk
    selsgkferlivalmyppyryeakelhdamkglgtkegviieilasrtknqlreimkaye
    edygssleediqadtsgylerilvcllqgsrddvssfvdpalalqdaqdlyaagekirgt
    demkfitilctrsathllrvfeeyekianksiedsiksethgsleeamltvvkctqnlhs
    yfaerlyyamkgagtrdgtlirnivsrseidlnlikchfkkmygktlssmimedtsgdyk
    nallslvgsdp