PDB entry 1w3u

View 1w3u on RCSB PDB site
Description: Crystal structure of phosphoserine aminotransferase from Bacillus circulans var. alkalophilus
Class: transferase
Keywords: transferase, phosphoserine aminotransferase, pyridoxal-5'-phosphate transferase, pyridine serine biosynthesis,
Deposited on 2004-07-20, released 2004-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.1441
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59196 (Start-361)
      • engineered mutation (2)
    Domains in SCOPe 2.07: d1w3ua_
  • Heterogens: PLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3uA (A:)
    mseraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarlla
    llgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthva
    asseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdils
    rpfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntp
    psfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmni
    tfrlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrs
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3uA (A:)
    eraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllall
    gnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaas
    seasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsrp
    fdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntpps
    fgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnitf
    rlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsrg