PDB entry 1w3t

View 1w3t on RCSB PDB site
Description: sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with d-kdgal, d-glyceraldehyde and pyruvate
Class: lyase
Keywords: lyase, archaeal metabolism, d-kdgal, pyruvate, d- glyceraldehyde
Deposited on 2004-07-19, released 2004-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.155
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3ta_
  • Chain 'B':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3tb_
  • Chain 'C':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3tc_
  • Chain 'D':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3td_
  • Heterogens: RSH, PYR, 3GR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3tA (A:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3tA (A:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w3tB (B:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3tB (B:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w3tC (C:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3tC (C:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w3tD (D:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3tD (D:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke