PDB entry 1w3s

View 1w3s on RCSB PDB site
Description: the crystal structure of reco from deinococcus radiodurans.
Class: DNA repair
Keywords: DNA repair, sad, cys4 zinc finger, ob-fold, reco
Deposited on 2004-07-18, released 2005-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein dr0819
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3sa1, d1w3sa2
  • Chain 'B':
    Compound: hypothetical protein dr0819
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3sb1, d1w3sb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3sA (A:)
    mrsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqv
    yqgphndlasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaasl
    rgvahqpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalp
    pyppavldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvpsgv
    pvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3sA (A:)
    rsrtanrsgivirrrvtpagdiivtlltpqgklkaiargssslnlfhhvgvqvyqgphnd
    lasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaaslrgvahqp
    dpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalppyppavl
    dflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w3sB (B:)
    mrsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqv
    yqgphndlasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaasl
    rgvahqpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalp
    pyppavldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvpsgv
    pvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3sB (B:)
    srtanrsgivirrrvtpagdiivtlltpqgklkaiarglssslnlfhhvgvqvyqgphnd
    lasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaaslrgvahqp
    dpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalppyppavl
    dflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvps