PDB entry 1w3o

View 1w3o on RCSB PDB site
Description: crystal structure of nima from d. radiodurans
Class: antibiotic resistance
Keywords: antibiotic resistance, deinococcus radiodurans, 5-nitroimidazole resistance, nim gene, catalytic mechanism
Deposited on 2004-07-17, released 2004-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.164
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nima-related protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W3O
    • Uniprot Q9RW27 (Start-215)
    Domains in SCOPe 2.07: d1w3oa1
  • Heterogens: ACT, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3oA (A:)
    msyyhhhhhhlestslykkagmsdfydprerdpsvsrrpqnrqsdewirelllrgtiarv
    atlwqgedgaafpfitplayayrpeqgdlvyhtnvvgrlranagqghpatlevseigqfl
    psnsplelsvqyrsvmvfgtarvlagedaraalttlservfpglkvgettrpiseddlkr
    tsvyslsidrwsgkenwaeqaiqeedwpalgpewlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3oA (A:)
    syyhhhhhhlsdfydprerdpsvsrrpqnrqsdewirelllrgtiarvatlwqgedgaaf
    pfitplayayrpeqgdlvyhtnvvgrlranagqghpatlevseigqflpsnsplelsvqy
    rsvmvfgtarvlagedaraalttlservfpglkvgettrpiseddlkrtsvyslsidrws
    gkenwaeqaiqeedwpalgpewlg