PDB entry 1w3n

View 1w3n on RCSB PDB site
Description: Sulfolobus solfataricus 2-keto-3-deoxygluconate (KDG) aldolase complex with D-KDG
Class: aldolase
Keywords: aldolase, archaeal metabolism, d-kdg
Deposited on 2004-07-17, released 2004-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w3na_
  • Chain 'B':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w3nb_
  • Chain 'C':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w3nc_
  • Chain 'D':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w3nd_
  • Heterogens: SSH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3nA (A:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3nA (A:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w3nB (B:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3nB (B:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w3nC (C:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3nC (C:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w3nD (D:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3nD (D:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke