PDB entry 1w3k

View 1w3k on RCSB PDB site
Description: endoglucanase cel5a from bacillus agaradhaerens in complex with cellobio derived-tetrahydrooxazine
Class: hydrolase
Keywords: glycoside hydrolase, cellulose degradation, endoglucanase, family 5, tetrahydrooxazine, hydrolase
Deposited on 2004-07-16, released 2004-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.114
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase 5a
    Species: BACILLUS AGARADHAERENS [TaxId:76935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3ka_
  • Heterogens: BGC, OXZ, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3kA (A:)
    dndsvveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginv
    fraamytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffd
    emselygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsq
    dvhhaadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggv
    fldeaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvreki
    res
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3kA (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires