PDB entry 1w3j

View 1w3j on RCSB PDB site
Description: family 1 b-glucosidase from thermotoga maritima in complex with tetrahydrooxazine
Class: hydrolase
Keywords: hydrolase, glucoside hydrolysis, family gh1, enzyme, tetrahydrooxazine
Deposited on 2004-07-16, released 2004-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W3J
    • Uniprot Q08638 (Start-467)
    Domains in SCOPe 2.07: d1w3ja_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W3J
    • Uniprot Q08638 (23-End)
    Domains in SCOPe 2.07: d1w3jb_
  • Heterogens: OXZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3jA (A:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3jA (A:)
    kkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwke
    dieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhwd
    lpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhapg
    mrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfmh
    qfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkfd
    pdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsed
    grvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdyst
    qkrivkdsgywysnvvknngled
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w3jB (B:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3jB (B:)
    nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
    kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
    wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
    pgmrdiyvafravhnllraharavkvfretvdgkigivfnngyfepasekeediravrfm
    hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
    dpdaakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsed
    grvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdyst
    qkrivkdsgywysnvvknngl