PDB entry 1w3i

View 1w3i on RCSB PDB site
Description: sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with pyruvate
Class: aldolase
Keywords: aldolase, archaeal metabolism, pyruvate
Deposited on 2004-07-15, released 2004-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3ia_
  • Chain 'B':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3ib_
  • Chain 'C':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3ic_
  • Chain 'D':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w3id_
  • Heterogens: PYR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w3iA (A:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w3iB (B:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w3iC (C:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w3iD (D:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke