PDB entry 1w3h

View 1w3h on RCSB PDB site
Description: the 3-dimensional structure of a thermostable mutant of a xylanase (xyn10a) from cellvibrio japonicus
Class: xylanase
Keywords: xylanase, calcium ion, thermostable, glycosyle hydrolase, family 10, error prone pcr, hydrolase, treble mutant,
Deposited on 2004-07-15, released 2004-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.218
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase a precursor
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W3H (Start-11)
      • engineered mutation (91)
      • engineered mutation (273)
    • Uniprot P14768 (12-End)
    Domains in SCOPe 2.07: d1w3ha_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase a precursor
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W3H
      • engineered mutation (91)
      • engineered mutation (273)
    • Uniprot P14768 (12-358)
    Domains in SCOPe 2.07: d1w3hb_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3hA (A:)
    macrstledrspglasladfpigvavaasggnadiftssarqnivraefnqitaenimkm
    symysgsnfsftnsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhi
    dtvaahfagqvkswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrrar
    aadptaelyyndfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirq
    amqkivalsptlkikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivq
    aylevvppgrrggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3hA (A:)
    spglasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfs
    ftnsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagq
    vkswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyy
    ndfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsp
    tlkikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgr
    rggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w3hB (B:)
    macrstledrspglasladfpigvavaasggnadiftssarqnivraefnqitaenimkm
    symysgsnfsftnsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhi
    dtvaahfagqvkswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrrar
    aadptaelyyndfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirq
    amqkivalsptlkikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivq
    aylevvppgrrggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3hB (B:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr