PDB entry 1w3g

View 1w3g on RCSB PDB site
Description: hemolytic lectin from the mushroom laetiporus sulphureus complexed with two n-acetyllactosamine molecules.
Deposited on 2004-07-15, released 2005-02-01
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemolytic lectin from laetiporus sulphureus
    Species: LAETIPORUS SULPHUREUS [TaxId:5630]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w3gA (A:)
    mtdiyippeglyfrllgfasrqvifarnspspdvglspvndqatdqyfsliygtgehagl
    yaikskatgkvlfsrrpaepyvgqidgdgrypdnwfkiepgktylskyfrlvqpstgtal
    vsrthlqpyfwnhpqtevfddqyftflfedmsidkieydlkdgrilsstpnvlatqtlen
    tssqtqemsfnlsqtltqtstfaytagftiavgtafkagvpifaetefkvdisvdnqwnw
    geentfsktytatfsvragpgetvkavstvdsgiinvpftaylsskstgfevttegiwrg
    vsswdlrhtltsvta
    

    Sequence, based on observed residues (ATOM records):
    >1w3gA (A:)
    diyippeglyfrllgfasrqvifarnspspdvglspvndqatdqyfsliygtgehaglya
    ikskatgkvlfsrrpaepyvgqidgdgrypdnwfkiepgktylskyfrlvqpstgtalvs
    rthlqpyfwnhpqtevfddqyftflfedmsidkieydlkdgrilsstpnvlatqtlents
    sqtqemsfnlsqtltqtstfaytagftiavgtafkagvpifaetefkvdisvdnqwnwge
    entfsktytatfsvragpgetvkavstvdsgiinvpftaylsskstgfevttegiwrgvs
    swdlrhtltsvta