PDB entry 1w3e

View 1w3e on RCSB PDB site
Description: ribosomal l30e of thermococcus celer, p59a mutant
Class: ribosomal protein
Keywords: ribosomal protein, thermal stable
Deposited on 2004-07-15, released 2006-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: 50s ribosomal protein l30e
    Species: THERMOCOCCUS CELER [TaxId:2264]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29160 (0-End)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d1w3ex1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1w3eX (X:)
    mvdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgia
    vyefegtsvelgtllgrphtvsalavvdpgesrilalggke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3eX (X:)
    mvdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgia
    vyefegtsvelgtllgrphtvsalavvdpgesrilalgg