PDB entry 1w3d

View 1w3d on RCSB PDB site
Description: nmr structure of the peripheral-subunit binding domain of bacillus stearothermophilus e2p
Class: transferase
Keywords: transferase, peripheral-subunit binding domain, dihydrolipoamide acetyltransferase, dihydrolipoamide dehydrogenase, protein- protein interaction, nmr, protein structure, multienzyme complex, bacillus sterothermophilus, glycolysis, acyltransferase, lipoyl
Deposited on 2004-07-14, released 2004-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W3D
    • Uniprot P11961 (Start-54)
    Domains in SCOPe 2.06: d1w3da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3dA (A:)
    gsaeaeagpnrrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3dA (A:)
    nrrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga