PDB entry 1w3d

View 1w3d on RCSB PDB site
Description: nmr structure of the peripheral-subunit binding domain of bacillus stearothermophilus e2p
Deposited on 2004-07-14, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-02, with a file datestamp of 2004-08-02.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1w3da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3dA (A:)
    gsaeaeagpnrrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3dA (A:)
    nrrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga