PDB entry 1w39

View 1w39 on RCSB PDB site
Description: crystal structure of an artificial top component of turnip yellow mosaic virus
Deposited on 2004-07-14, released 2004-08-16
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-16, with a file datestamp of 2004-08-16.
Experiment type: XRAY
Resolution: 3.75 Å
R-factor: 0.2453
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1w39a_
  • Chain 'B':
    Domains in SCOP 1.69: d1w39b_
  • Chain 'C':
    Domains in SCOP 1.69: d1w39c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w39A (A:)
    meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
    tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
    aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
    splitdtst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w39A (A:)
    qdrtvtspltikqpfqsevlfagtkdaeasltianidsvstlttfyrhasleslwvtihp
    tlqaptfpttvgvcwvpaqspvtpaqitktyggqifciggaiqtlsplivkcplemmqpr
    vkdsiqyldspkllisitaqptappastciitvsgtlsmhsplitdtst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w39B (B:)
    meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
    tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
    aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
    splitdtst
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w39C (C:)
    meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
    tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
    aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
    splitdtst