PDB entry 1w37

View 1w37 on RCSB PDB site
Description: 2-keto-3-deoxygluconate(kdg) aldolase of sulfolobus solfataricus
Class: aldolase
Keywords: aldolase, archaeal metabolism, thermostability,
Deposited on 2004-07-13, released 2004-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w37a_
  • Chain 'B':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w37b_
  • Chain 'C':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w37c_
  • Chain 'D':
    Compound: 2-keto-3-deoxy gluconate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w37d_
  • Heterogens: GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w37A (A:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w37A (A:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w37B (B:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w37B (B:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w37C (C:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w37C (C:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w37D (D:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w37D (D:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke