PDB entry 1w36

View 1w36 on RCSB PDB site
Description: recbcd:DNA complex
Class: recombination
Keywords: recombination, helicase, nuclease, hydrolase, DNA repair
Deposited on 2004-07-13, released 2004-11-04
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.242
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: exodeoxyribonuclease v beta chain
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w36b1, d1w36b2, d1w36b3
  • Chain 'C':
    Compound: exodeoxyribonuclease v gamma chain
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w36c1, d1w36c2, d1w36c3
  • Chain 'D':
    Compound: exodeoxyribonuclease v alpha chain
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w36d1, d1w36d2
  • Chain 'E':
    Compound: exodeoxyribonuclease v beta chain
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w36e1, d1w36e2, d1w36e3
  • Chain 'F':
    Compound: exodeoxyribonuclease v gamma chain
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w36f1, d1w36f2, d1w36f3
  • Chain 'G':
    Compound: exodeoxyribonuclease v alpha chain
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w36g1, d1w36g2
  • Chain 'Y':
    Compound: DNA hairpin
  • Chain 'Z':
    Compound: DNA hairpin
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w36B (B:)
    msdvaetldplrlplqgerlieasagtgktftiaalylrlllglggsaafprpltveell
    vvtfteaataelrgrirsnihelriaclrettdnplyerlleeiddkaqaaqwlllaerq
    mdeaavftihgfcqrmlnlnafesgmlfeqqliedesllryqacadfwrrhcyplpreia
    qvvfetwkgpqallrdinrylqgeapvikapppddetlasrhaqivaridtvkqqwrdav
    geldaliessgidrrkfnrsnqakwidkisawaeeetnsyqlpeslekfsqrfledrtka
    ggetprhplfeaidqllaeplsirdlvitralaeiretvarekrrrgelgfddmlsrlds
    alrsesgevlaaairtrfpvamidefqdtdpqqyrifrriwhhqpetallligdpkqaiy
    afrgadiftymkarsevhahytldtnwrsapgmvnsvnklfsqtddafmfreipfipvks
    agknqalrfvfkgetqpamkmwlmegescgvgdyqstmaqvcaaqirdwlqagqrgeall
    mngddarpvrasdisvlvrsrqeaaqvrdaltlleipsvylsnrdsvfetleaqemlwll
    qavmtperentlrsalatsmmglnaldietlnndehawdvvveefdgyrqiwrkrgvmpm
    lralmsarniaenllataggerrltdilhisellqeagtqlesehalvrwlsqhilepds
    nassqqmrlesdkhlvqivtihkskgleyplvwlpfitnfrvqeqafyhdrhsfeavldl
    naapesvdlaeaerlaedlrllyvaltrsvwhcslgvaplvrrrgdkkgdtdvhqsalgr
    llqkgepqdaaglrtciealcdddiawqtaqtgdnqpwqvndvstaelnaktlqrlpgdn
    wrvtsysglqqrghgiaqdlmprldvdaagvasvveeptltphqfprgaspgtflhslfe
    dldftqpvdpnwvreklelggfesqwepvltewitavlqaplnetgvslsqlsarnkqve
    mefylpisepliasqldtlirqfdplsagcpplefmqvrgmlkgfidlvfrhegryylld
    yksnwlgedssaytqqamaaamqahrydlqyqlytlalhrylrhriadydyehhfggviy
    lflrgvdkehpqqgiyttrpnaglialmdemfagmtleea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w36B (B:)
    msdvaetldplrlplqgerlieasagtgktftiaalylrlllglggsaafprpltveell
    vvtfteaataelrgrirsnihelriaclrettdnplyerlleeiddkaqaaqwlllaerq
    mdeaavftihgfcqrmlnlnafesgmlfeqqliedesllryqacadfwrrhcyplpreia
    qvvfetwkgpqallrdinrylqgeapvikapppddetlasrhaqivaridtvkqqwrdav
    geldaliessgidrrkfnrsnqakwidkisawaeeetnsyqlpeslekprhplfeaidql
    laeplsirdlvitralaeiretvarekrrrgelgfddmlsrldsalrsesgevlaaairt
    rfpvamidefqdtdpqqyrifrriwhhqpetallligdpkqaiyafrgadiftymkarse
    vhahytldtnwrsapgmvnsvnklfsqtddafmfreipfipvksagknqalrfvfkgetq
    pamkmwlmegescgvgdyqstmaqvcaaqirdwlqagqrgeallmngddarpvrasdisv
    lvrsrqeaaqvrdaltlleipsvylsnrdsvfetleaqemlwllqavmtperentlrsal
    atsmmglnaldietlnndehawdvvveefdgyrqiwrkrgvmpmlralmsarniaenlla
    taggerrltdilhisellqeagtqlesehalvrwlsqhilepdsnassqqmrlesdkhlv
    qivtihkskgleyplvwlpfitnfrvqeqafyhdrhsfeavldlnaapesvdlaeaerla
    edlrllyvaltrsvwhcslgvaplvrrrgdkkgdtdvhqsalgrllqkgepqdaaglrtc
    iealcdddiawqtaqtgdnqpwqvndvstaelnaktlqrlpgdnwrvtsysglqqrghgi
    aqdlmprldvdaagvasvveeptltphqfprgaspgtflhslfedldftqpvdpnwvrek
    lelggfesqwepvltewitavlqaplnetgvslsqlsarnkqvemefylpisepliasql
    dtlirqfdplsagcpplefmqvrgmlkgfidlvfrhegryylldyksnwlgedssaytqq
    amaaamqahrydlqyqlytlalhrylrhriadydyehhfggviylflrgvdkehpqqgiy
    ttrpnaglialmdemfag
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w36C (C:)
    mlrvyhsnrldvlealmefivererlddpfepemilvqstgmaqwlqmtlsqkfgiaani
    dfplpasfiwdmfvrvlpeipkesafnkqsmswklmtllpqlleredftllrhyltddsd
    krklfqlsskaadlfdqylvyrpdwlaqwetghlveglgeaqawqaplwkalveythqlg
    qprwhranlyqrfietlesattcppglpsrvficgisalppvylqalqalgkhieihllf
    tnpcryywgdikdpaylaklltrqrrhsfedrelplfrdsenagqlfnsdgeqdvgnpll
    aswgklgrdyiyllsdlessqeldafvdvtpdnllhniqsdilelenravagvnieefsr
    sdnkrpldpldssitfhvchspqrevevlhdrllamleedptltprdiivmvadidsysp
    fiqavfgsapadrylpyaisdrrarqshpvleafisllslpdsrfvsedvlalldvpvla
    arfditeeglrylrqwvnesgirwgidddnvrelelpatgqhtwrfgltrmllgyamesa
    qgewqsvlpydessgliaelvghlasllmqlniwrrglaqerpleewlpvcrdmlnaffl
    pdaeteaamtlieqqwqaiiaeglgaqygdavplsllrdelaqrldqerisqrflagpvn
    ictlmpmrsipfkvvcllgmndgvyprqlaplgfdlmsqkpkrgdrsrrdddrylfleal
    isaqqklyisyigrsiqdnserfpsvlvqelidyigqshylpgdealncdesearvkahl
    tclhtrmpfdpqnyqpgerqsyarewlpaasqagkahsefvqplpftlpetvpletlqrf
    wahpvraffqmrlqvnfrtedseipdtepfileglsryqinqqllnalveqddaerlfrr
    fraagdlpygafgeifwetqcqemqqladrviacrqpgqsmeidlacngvqitgwlpqvq
    pdgllrwrpsllsvaqgmqlwlehlvycasggngesrlflrkdgewrfpplaaeqalhyl
    sqliegyregmsapllvlpesggawlktcydaqndamldddstlqkartkflqayegnmm
    vrgegddiwyqrlwrqltpetmeaiveqsqrfllplfrfnqs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w36D (D:)
    mklqkqlleavehkqlrpldvqfaltvagdehpavtlaaallshdageghvclplsrlen
    neashpllatcvseigelqnweecllasqavsrgdeptpmilcgdrlylnrmwcnertva
    rffnevnhaievdeallaqtldklfpvsdeinwqkvaaavaltrrisvisggpgtgkttt
    vakllaaliqmadgercrirlaaptgkaaarlteslgkalrqlpltdeqkkripedastl
    hrllgaqpgsqrlrhhagnplhldvlvvdeasmidlpmmsrlidalpdharviflgdrdq
    lasveagavlgdicayanagftaerarqlsrltgthvpagtgteaaslrdslcllqksyr
    fgsdsgigqlaaainrgdktavktvfqqdftdiekrllqsgedyiamleealagygryld
    llqaraepdliiqafneyqllcalregpfgvaglnerieqfmqqkrkihrhphsrwyegr
    pvmiarndsalglfngdigialdrgqgtrvwfampdgniksvqpsrlpehettwamtvhk
    sqgsefdhaalilpsqrtpvvtrelvytavtrarrrlslyaderilsaaiatrterrsgl
    aalfssre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w36D (D:)
    klqkqlleavehkqlrpldvqfaltvagdehpavtlaaallshdageghvclplsrlenn
    eashpllatcvseigelqnweecllasqavsrgdeptpmilcgdrlylnrmwcnertvar
    ffnevnhaievdeallaqtldklfpvsdeinwqkvaaavaltrrisvisggpgtgktttv
    akllaaliqmadgercrirlaaptgkaaarlteslgkalrqlpltdeqkkripedastlh
    rllhagnplhldvlvvdeasmidlpmmsrlidalpdharviflgdrdqlasveagavlgd
    icayanagftaerarqlsrltgthvpagtgteaaslrdslcllqksyrfgsdsgigqlaa
    ainrgdktavktvfqqdftdiekrllqsgedyiamleealagygryldllqaraepdlii
    qafneyqllcalregpfgvaglnerieqfmqqkrqpsrlpehettwamtvhksqgsefdh
    aalilpsqrtpvvtrelvytavtrarrrlslyaderilsaaiatrterrsglaalfssr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w36E (E:)
    msdvaetldplrlplqgerlieasagtgktftiaalylrlllglggsaafprpltveell
    vvtfteaataelrgrirsnihelriaclrettdnplyerlleeiddkaqaaqwlllaerq
    mdeaavftihgfcqrmlnlnafesgmlfeqqliedesllryqacadfwrrhcyplpreia
    qvvfetwkgpqallrdinrylqgeapvikapppddetlasrhaqivaridtvkqqwrdav
    geldaliessgidrrkfnrsnqakwidkisawaeeetnsyqlpeslekfsqrfledrtka
    ggetprhplfeaidqllaeplsirdlvitralaeiretvarekrrrgelgfddmlsrlds
    alrsesgevlaaairtrfpvamidefqdtdpqqyrifrriwhhqpetallligdpkqaiy
    afrgadiftymkarsevhahytldtnwrsapgmvnsvnklfsqtddafmfreipfipvks
    agknqalrfvfkgetqpamkmwlmegescgvgdyqstmaqvcaaqirdwlqagqrgeall
    mngddarpvrasdisvlvrsrqeaaqvrdaltlleipsvylsnrdsvfetleaqemlwll
    qavmtperentlrsalatsmmglnaldietlnndehawdvvveefdgyrqiwrkrgvmpm
    lralmsarniaenllataggerrltdilhisellqeagtqlesehalvrwlsqhilepds
    nassqqmrlesdkhlvqivtihkskgleyplvwlpfitnfrvqeqafyhdrhsfeavldl
    naapesvdlaeaerlaedlrllyvaltrsvwhcslgvaplvrrrgdkkgdtdvhqsalgr
    llqkgepqdaaglrtciealcdddiawqtaqtgdnqpwqvndvstaelnaktlqrlpgdn
    wrvtsysglqqrghgiaqdlmprldvdaagvasvveeptltphqfprgaspgtflhslfe
    dldftqpvdpnwvreklelggfesqwepvltewitavlqaplnetgvslsqlsarnkqve
    mefylpisepliasqldtlirqfdplsagcpplefmqvrgmlkgfidlvfrhegryylld
    yksnwlgedssaytqqamaaamqahrydlqyqlytlalhrylrhriadydyehhfggviy
    lflrgvdkehpqqgiyttrpnaglialmdemfagmtleea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w36E (E:)
    msdvaetldplrlplqgerlieasagtgktftiaalylrlllglggsaafprpltveell
    vvtfteaataelrgrirsnihelriaclrettdnplyerlleeiddkaqaaqwlllaerq
    mdeaavftihgfcqrmlnlnafesgmlfeqqliedesllryqacadfwrrhcyplpreia
    qvvfetwkgpqallrdinrylqgeapvikapppddetlasrhaqivaridtvkqqwrdav
    geldaliessgidrrkfnrsnqakwidkisawaeeetnsyqlpeslekprhplfeaidql
    laeplsirdlvitralaeiretvarekrrrgelgfddmlsrldsalrsesgevlaaairt
    rfpvamidefqdtdpqqyrifrriwhhqpetallligdpkqaiyafrgadiftymkarse
    vhahytldtnwrsapgmvnsvnklfsqtddafmfreipfipvksagknqalrfvfkgetq
    pamkmwlmegescgvgdyqstmaqvcaaqirdwlqagqrgeallmngddarpvrasdisv
    lvrsrqeaaqvrdaltlleipsvylsnrdsvfetleaqemlwllqavmtperentlrsal
    atsmmglnaldietlnndehawdvvveefdgyrqiwrkrgvmpmlralmsarniaenlla
    taggerrltdilhisellqeagtqlesehalvrwlsqhilepdsnassqqmrlesdkhlv
    qivtihkskgleyplvwlpfitnfrvqeqafyhdrhsfeavldlnaapesvdlaeaerla
    edlrllyvaltrsvwhcslgvaplvrrrgdkkgdtdvhqsalgrllqkgepqdaaglrtc
    iealcdddiawqtaqtgdnqpwqvndvstaelnaktlqrlpgdnwrvtsysglqqrghgi
    aqdlmprldvdaagvasvveeptltphqfprgaspgtflhslfedldftqpvdpnwvrek
    lelggfesqwepvltewitavlqaplnetgvslsqlsarnkqvemefylpisepliasql
    dtlirqfdplsagcpplefmqvrgmlkgfidlvfrhegryylldyksnwlgedssaytqq
    amaaamqahrydlqyqlytlalhrylrhriadydyehhfggviylflrgvdkehpqqgiy
    ttrpnaglialmdemfag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w36F (F:)
    mlrvyhsnrldvlealmefivererlddpfepemilvqstgmaqwlqmtlsqkfgiaani
    dfplpasfiwdmfvrvlpeipkesafnkqsmswklmtllpqlleredftllrhyltddsd
    krklfqlsskaadlfdqylvyrpdwlaqwetghlveglgeaqawqaplwkalveythqlg
    qprwhranlyqrfietlesattcppglpsrvficgisalppvylqalqalgkhieihllf
    tnpcryywgdikdpaylaklltrqrrhsfedrelplfrdsenagqlfnsdgeqdvgnpll
    aswgklgrdyiyllsdlessqeldafvdvtpdnllhniqsdilelenravagvnieefsr
    sdnkrpldpldssitfhvchspqrevevlhdrllamleedptltprdiivmvadidsysp
    fiqavfgsapadrylpyaisdrrarqshpvleafisllslpdsrfvsedvlalldvpvla
    arfditeeglrylrqwvnesgirwgidddnvrelelpatgqhtwrfgltrmllgyamesa
    qgewqsvlpydessgliaelvghlasllmqlniwrrglaqerpleewlpvcrdmlnaffl
    pdaeteaamtlieqqwqaiiaeglgaqygdavplsllrdelaqrldqerisqrflagpvn
    ictlmpmrsipfkvvcllgmndgvyprqlaplgfdlmsqkpkrgdrsrrdddrylfleal
    isaqqklyisyigrsiqdnserfpsvlvqelidyigqshylpgdealncdesearvkahl
    tclhtrmpfdpqnyqpgerqsyarewlpaasqagkahsefvqplpftlpetvpletlqrf
    wahpvraffqmrlqvnfrtedseipdtepfileglsryqinqqllnalveqddaerlfrr
    fraagdlpygafgeifwetqcqemqqladrviacrqpgqsmeidlacngvqitgwlpqvq
    pdgllrwrpsllsvaqgmqlwlehlvycasggngesrlflrkdgewrfpplaaeqalhyl
    sqliegyregmsapllvlpesggawlktcydaqndamldddstlqkartkflqayegnmm
    vrgegddiwyqrlwrqltpetmeaiveqsqrfllplfrfnqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w36F (F:)
    mlrvyhsnrldvlealmefivererlddpfepemilvqstgmaqwlqmtlsqkfgiaani
    dfplpasfiwdmfvrvlpeipkesafnkqsmswklmtllpqlleredftllrhyltddsd
    krklfqlsskaadlfdqylvyrpdwlaqwetghlveglgeaqawqaplwkalveythqlg
    qprwhranlyqrfietlesattcppglpsrvficgisalppvylqalqalgkhieihllf
    tnpcryywgdvgnpllaswgklgrdyiyllsdlessqeldafvdvtpdnllhniqsdile
    lenravagvnieefsrsdnkrpldpldssitfhvchspqrevevlhdrllamleedptlt
    prdiivmvadidsyspfiqavfgsapadrylpyaisdrrarqshpvleafisllslpdsr
    fvsedvlalldvpvlaarfditeeglrylrqwvnesgirwgidddnvrelelpatgqhtw
    rfgltrmllgyamesaqgewqsvlpydessgliaelvghlasllmqlniwrrglaqerpl
    eewlpvcrdmlnafflpdaeteaamtlieqqwqaiiaeglgaqygdavplsllrdelaqr
    ldqerisqrflagpvnictlmpmrsipfkvvcllgmndgvyprqlaplgfdlmsqkpkrg
    drsrrdddrylflealisaqqklyisyigrsiqdnserfpsvlvqelidyigqshylpgd
    ealncdesearvkahltclhtrmpfdpqnyqpgerqsyarewlpaasqagkahsefvqpl
    pftlpetvpletlqrfwahpvraffqmrlqvnfrtedseipdtepfileglsryqinqql
    lnalveqddaerlfrrfraagdlpygafgeifwetqcqemqqladrviacrqpgqsmeid
    lacngvqitgwlpqvqpdgllrwrpsllsvaqgmqlwlehlvycasggngesrlflrkdg
    ewrfpplaaeqalhylsqliegyregmsapllvlpesggawlktcydaqndamldddstl
    qkartkflqayegnmmvrgegddiwyqrlwrqltpetmeaiveqsqrfllplfrfnqs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w36G (G:)
    mklqkqlleavehkqlrpldvqfaltvagdehpavtlaaallshdageghvclplsrlen
    neashpllatcvseigelqnweecllasqavsrgdeptpmilcgdrlylnrmwcnertva
    rffnevnhaievdeallaqtldklfpvsdeinwqkvaaavaltrrisvisggpgtgkttt
    vakllaaliqmadgercrirlaaptgkaaarlteslgkalrqlpltdeqkkripedastl
    hrllgaqpgsqrlrhhagnplhldvlvvdeasmidlpmmsrlidalpdharviflgdrdq
    lasveagavlgdicayanagftaerarqlsrltgthvpagtgteaaslrdslcllqksyr
    fgsdsgigqlaaainrgdktavktvfqqdftdiekrllqsgedyiamleealagygryld
    llqaraepdliiqafneyqllcalregpfgvaglnerieqfmqqkrkihrhphsrwyegr
    pvmiarndsalglfngdigialdrgqgtrvwfampdgniksvqpsrlpehettwamtvhk
    sqgsefdhaalilpsqrtpvvtrelvytavtrarrrlslyaderilsaaiatrterrsgl
    aalfssre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w36G (G:)
    klqkqlleavehkqlrpldvqfaltvagdehpavtlaaallshdageghvclplsrlenn
    eashpllatcvseigelqnweecllasqavsrgdeptpmilcgdrlylnrmwcnertvar
    ffnevnhaievdeallaqtldklfpvsdeinwqkvaaavaltrrisvisggpgtgktttv
    akllaaliqmadgercrirlaaptgkaaarlteslgkalrqlpltdeqkkripedastlh
    rllhagnplhldvlvvdeasmidlpmmsrlidalpdharviflgdrdqlasveagavlgd
    icayanagftaerarqlsrltgthvpagtgteaaslrdslcllqksyrfgsdsgigqlaa
    ainrgdktavktvfqqdftdiekrllqsgedyiamleealagygryldllqaraepdlii
    qafneyqllcalregpfgvaglnerieqfmqqkrqpsrlpehettwamtvhksqgsefdh
    aalilpsqrtpvvtrelvytavtrarrrlslyaderilsaaiatrterrsglaalfssr
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.