PDB entry 1w34

View 1w34 on RCSB PDB site
Description: ferredoxin-nadp reductase (mutation: y 303 s)
Class: oxidoreductase
Keywords: 3d-structure, fad, flavoprotein, fnr, membrane, nadp, nadp reductase, oxidoreductase, phycobilisome, thylakoid
Deposited on 2004-07-13, released 2005-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.185
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp reductase
    Species: ANABAENA SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-303)
      • conflict (246)
      • engineered mutation (303)
    Domains in SCOPe 2.08: d1w34a1, d1w34a2
  • Heterogens: FAD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w34A (A:)
    mtqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqs
    igiippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcst
    ylthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanp
    eyqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdr
    vaehadqlwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwh
    vets
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w34A (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
    qliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvets