PDB entry 1w33

View 1w33 on RCSB PDB site
Description: bbcrasp-1 from borrelia burgdorferi
Deposited on 2004-07-13, released 2005-02-09
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bbcrasp-1
    Species: BORRELIA BURGDORFERI [TaxId:445985]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: bbcrasp-1
    Species: BORRELIA BURGDORFERI [TaxId:445985]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1w33A (A:)
    etiaselkaigkeledqkkeeniqiakiakekfdflstfkvgpydlidediqmkikrtly
    ssldykkenieklkeileilkknsehyniigrliyhiswgiqfqieqnleliqngvenls
    qeesksllmqiksnleikqrlkktlnetlkvynqntqdnekilaehfnkyykdfdtlkpa
    f
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1w33B (B:)
    etiaselkaigkeledqkkeeniqiakiakekfdflstfkvgpydlidediqmkikrtly
    ssldykkenieklkeileilkknsehyniigrliyhiswgiqfqieqnleliqngvenls
    qeesksllmqiksnleikqrlkktlnetlkvynqntqdnekilaehfnkyykdfdtlkpa
    f
    

    Sequence, based on observed residues (ATOM records):
    >1w33B (B:)
    etiaselkaigkeledqkkeeniqiakiakekfdflstfkvgpydlidediqmkikrtly
    ssldykkenieklkeileilkknsehyniigrliyhiswgiqfqieqnleliqngvenls
    qeesksllmqiksnleikqrlkktlnetlkvynqntqdnekilaehfnkyykdfdtlkpa