PDB entry 1w32

View 1w32 on RCSB PDB site
Description: the 3-dimensional structure of a thermostable mutant of a xylanase (xyn10a) from cellvibrio japonicus
Class: hydrolase
Keywords: xylanase, mutant, calcium ion, thermostable, glycosyle hydrolase, family 10, error prone pcr, hydrolase
Deposited on 2004-07-12, released 2004-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.122
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase a precursor
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W32
      • engineered mutation (262)
    • Uniprot P14768 (1-End)
    Domains in SCOPe 2.08: d1w32a_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase a precursor
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W32
      • engineered mutation (262)
    • Uniprot P14768 (1-End)
    Domains in SCOPe 2.08: d1w32b_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w32A (A:)
    mglasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsf
    tnsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqv
    kswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyyn
    dfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalspt
    lkikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgrr
    ggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w32A (A:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w32B (B:)
    mglasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsf
    tnsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqv
    kswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyyn
    dfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalspt
    lkikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgrr
    ggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w32B (B:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg