PDB entry 1w30

View 1w30 on RCSB PDB site
Description: PyrR of Mycobacterium Tuberculosis as a potential drug target
Class: transferase
Keywords: pyrr, transferase, glycosyltransferase, psi, protein structure initiative, tb structural genomics consortium, tb, tbsgc
Deposited on 2004-07-11, released 2004-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PyrR bifunctional protein
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71807 (Start-192)
      • engineered mutation (20)
    • PDB 1W30
    Domains in SCOPe 2.07: d1w30a_
  • Chain 'B':
    Compound: PyrR bifunctional protein
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71807 (Start-192)
      • engineered mutation (20)
    • PDB 1W30
    Domains in SCOPe 2.07: d1w30b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w30A (A:)
    mgaagdaaigresrelmsaanvgrtisriahqiiektalddpvgpdaprvvllgiptrgv
    tlanrlagniteysgihvghgalditlyrddlmikpprplastsipaggiddalvilvdd
    vlysgrsvrsaldalrdvgrpravqlavlvdrghrelplradyvgknvptsrsesvhvrl
    rehdgrdgvvisrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w30A (A:)
    esrelmsaanvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
    eysgihvghgalditlyrdplastsipaggiddalvilvddvlysgrsvrsaldalrdvg
    rpravqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvisr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w30B (B:)
    mgaagdaaigresrelmsaanvgrtisriahqiiektalddpvgpdaprvvllgiptrgv
    tlanrlagniteysgihvghgalditlyrddlmikpprplastsipaggiddalvilvdd
    vlysgrsvrsaldalrdvgrpravqlavlvdrghrelplradyvgknvptsrsesvhvrl
    rehdgrdgvvisrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w30B (B:)
    esrelmsaanvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
    eysgihvghgalditlyrdpprplastsipaggiddalvilvddvlysgrsvrsaldalr
    dvgrpravqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvisr