PDB entry 1w2z

View 1w2z on RCSB PDB site
Description: PSAO and Xenon
Class: oxidoreductase
Keywords: glycoprotein, manganese, metal-binding oxidase, oxidoreductase, pea seedling, tpq oxidoreductase, copper amine, oxidase, quinone, xenon
Deposited on 2004-07-11, released 2004-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.181
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase, copper containing
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2za1, d1w2za2, d1w2za3
  • Chain 'B':
    Compound: amine oxidase, copper containing
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2zb1, d1w2zb2, d1w2zb3
  • Chain 'C':
    Compound: amine oxidase, copper containing
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2zc1, d1w2zc2, d1w2zc3
  • Chain 'D':
    Compound: amine oxidase, copper containing
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2zd1, d1w2zd2, d1w2zd3
  • Heterogens: CU, MN, XE, NAG, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2zA (A:)
    vtplhvqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptl
    vsiprkifvvaiinsqtheilinlrirsivsdnihngygfpilsvdeqslaiklplkypp
    fidsvkkrglnlseivcssftmgwfgeeknvrtvrldcfmkestvniyvrpitgitivad
    ldlmkiveyhdrdieavptaenteyqvskqsppfgpkqhsltshqpqgpgfqinghsvsw
    anwkfhigfdvragivislasiydlekhksrrvlykgyiselfvpyqdpteefyfktffd
    sgefgfglstvslipnrdcpphaqfidtyvhsangtpillknaicvfeqygnimwrhten
    gipnesieesrtevnlivrtivtvgnydnvidwefkasgsikpsialsgileikgtnikh
    kdeikedlhgklvsansigiyhdhfyiyyldfdidgthnsfektslktvrikdgsskrks
    ywttetqtaktesdakitiglapaelvvvnpniktavgnevgyrlipaipahpllteddy
    pqirgaftnynvwvtaynrtekwagglyvdhsrgddtlavwtkqnreivnkdivmwhvvg
    ihhvpaqedfpimpllstsfelrptnffernpvlktlsprdvawpgcsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2zA (A:)
    vqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptlvsipr
    kifvvaiinsqtheilinlrirsivsdnihngygfpilsvdeqslaiklplkyppfidsv
    kkrglnlseivcssftmgwfgeeknvrtvrldcfmkestvniyvrpitgitivadldlmk
    iveyhdrdieavptaenteyqvskqsppfgpkqhsltshqpqgpgfqinghsvswanwkf
    higfdvragivislasiydlekhksrrvlykgyiselfvpyqdpteefyfktffdsgefg
    fglstvslipnrdcpphaqfidtyvhsangtpillknaicvfeqygnimwrhtengipne
    sieesrtevnlivrtivtvgnydnvidwefkasgsikpsialsgileikgtnikhkdeik
    edlhgklvsansigiyhdhfyiyyldfdidgthnsfektslktvrikdgsskrksywtte
    tqtaktesdakitiglapaelvvvnpniktavgnevgyrlipaipahpllteddypqirg
    aftnynvwvtaynrtekwagglyvdhsrgddtlavwtkqnreivnkdivmwhvvgihhvp
    aqedfpimpllstsfelrptnffernpvlktlsprdvawpgc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2zB (B:)
    vtplhvqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptl
    vsiprkifvvaiinsqtheilinlrirsivsdnihngygfpilsvdeqslaiklplkypp
    fidsvkkrglnlseivcssftmgwfgeeknvrtvrldcfmkestvniyvrpitgitivad
    ldlmkiveyhdrdieavptaenteyqvskqsppfgpkqhsltshqpqgpgfqinghsvsw
    anwkfhigfdvragivislasiydlekhksrrvlykgyiselfvpyqdpteefyfktffd
    sgefgfglstvslipnrdcpphaqfidtyvhsangtpillknaicvfeqygnimwrhten
    gipnesieesrtevnlivrtivtvgnydnvidwefkasgsikpsialsgileikgtnikh
    kdeikedlhgklvsansigiyhdhfyiyyldfdidgthnsfektslktvrikdgsskrks
    ywttetqtaktesdakitiglapaelvvvnpniktavgnevgyrlipaipahpllteddy
    pqirgaftnynvwvtaynrtekwagglyvdhsrgddtlavwtkqnreivnkdivmwhvvg
    ihhvpaqedfpimpllstsfelrptnffernpvlktlsprdvawpgcsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2zB (B:)
    vqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptlvsipr
    kifvvaiinsqtheilinlrirsivsdnihngygfpilsvdeqslaiklplkyppfidsv
    kkrglnlseivcssftmgwfgeeknvrtvrldcfmkestvniyvrpitgitivadldlmk
    iveyhdrdieavptaenteyqvskqsppfgpkqhsltshqpqgpgfqinghsvswanwkf
    higfdvragivislasiydlekhksrrvlykgyiselfvpyqdpteefyfktffdsgefg
    fglstvslipnrdcpphaqfidtyvhsangtpillknaicvfeqygnimwrhtengipne
    sieesrtevnlivrtivtvgnydnvidwefkasgsikpsialsgileikgtnikhkdeik
    edlhgklvsansigiyhdhfyiyyldfdidgthnsfektslktvrikdgsskrksywtte
    tqtaktesdakitiglapaelvvvnpniktavgnevgyrlipaipahpllteddypqirg
    aftnynvwvtaynrtekwagglyvdhsrgddtlavwtkqnreivnkdivmwhvvgihhvp
    aqedfpimpllstsfelrptnffernpvlktlsprdvawpgc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w2zC (C:)
    vtplhvqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptl
    vsiprkifvvaiinsqtheilinlrirsivsdnihngygfpilsvdeqslaiklplkypp
    fidsvkkrglnlseivcssftmgwfgeeknvrtvrldcfmkestvniyvrpitgitivad
    ldlmkiveyhdrdieavptaenteyqvskqsppfgpkqhsltshqpqgpgfqinghsvsw
    anwkfhigfdvragivislasiydlekhksrrvlykgyiselfvpyqdpteefyfktffd
    sgefgfglstvslipnrdcpphaqfidtyvhsangtpillknaicvfeqygnimwrhten
    gipnesieesrtevnlivrtivtvgnydnvidwefkasgsikpsialsgileikgtnikh
    kdeikedlhgklvsansigiyhdhfyiyyldfdidgthnsfektslktvrikdgsskrks
    ywttetqtaktesdakitiglapaelvvvnpniktavgnevgyrlipaipahpllteddy
    pqirgaftnynvwvtaynrtekwagglyvdhsrgddtlavwtkqnreivnkdivmwhvvg
    ihhvpaqedfpimpllstsfelrptnffernpvlktlsprdvawpgcsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2zC (C:)
    vqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptlvsipr
    kifvvaiinsqtheilinlrirsivsdnihngygfpilsvdeqslaiklplkyppfidsv
    kkrglnlseivcssftmgwfgeeknvrtvrldcfmkestvniyvrpitgitivadldlmk
    iveyhdrdieavptaenteyqvskqsppfgpkqhsltshqpqgpgfqinghsvswanwkf
    higfdvragivislasiydlekhksrrvlykgyiselfvpyqdpteefyfktffdsgefg
    fglstvslipnrdcpphaqfidtyvhsangtpillknaicvfeqygnimwrhtengipne
    sieesrtevnlivrtivtvgnydnvidwefkasgsikpsialsgileikgtnikhkdeik
    edlhgklvsansigiyhdhfyiyyldfdidgthnsfektslktvrikdgsskrksywtte
    tqtaktesdakitiglapaelvvvnpniktavgnevgyrlipaipahpllteddypqirg
    aftnynvwvtaynrtekwagglyvdhsrgddtlavwtkqnreivnkdivmwhvvgihhvp
    aqedfpimpllstsfelrptnffernpvlktlsprdvawpgc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w2zD (D:)
    vtplhvqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptl
    vsiprkifvvaiinsqtheilinlrirsivsdnihngygfpilsvdeqslaiklplkypp
    fidsvkkrglnlseivcssftmgwfgeeknvrtvrldcfmkestvniyvrpitgitivad
    ldlmkiveyhdrdieavptaenteyqvskqsppfgpkqhsltshqpqgpgfqinghsvsw
    anwkfhigfdvragivislasiydlekhksrrvlykgyiselfvpyqdpteefyfktffd
    sgefgfglstvslipnrdcpphaqfidtyvhsangtpillknaicvfeqygnimwrhten
    gipnesieesrtevnlivrtivtvgnydnvidwefkasgsikpsialsgileikgtnikh
    kdeikedlhgklvsansigiyhdhfyiyyldfdidgthnsfektslktvrikdgsskrks
    ywttetqtaktesdakitiglapaelvvvnpniktavgnevgyrlipaipahpllteddy
    pqirgaftnynvwvtaynrtekwagglyvdhsrgddtlavwtkqnreivnkdivmwhvvg
    ihhvpaqedfpimpllstsfelrptnffernpvlktlsprdvawpgcsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2zD (D:)
    vqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptlvsipr
    kifvvaiinsqtheilinlrirsivsdnihngygfpilsvdeqslaiklplkyppfidsv
    kkrglnlseivcssftmgwfgeeknvrtvrldcfmkestvniyvrpitgitivadldlmk
    iveyhdrdieavptaenteyqvskqsppfgpkqhsltshqpqgpgfqinghsvswanwkf
    higfdvragivislasiydlekhksrrvlykgyiselfvpyqdpteefyfktffdsgefg
    fglstvslipnrdcpphaqfidtyvhsangtpillknaicvfeqygnimwrhtengipne
    sieesrtevnlivrtivtvgnydnvidwefkasgsikpsialsgileikgtnikhkdeik
    edlhgklvsansigiyhdhfyiyyldfdidgthnsfektslktvrikdgsskrksywtte
    tqtaktesdakitiglapaelvvvnpniktavgnevgyrlipaipahpllteddypqirg
    aftnynvwvtaynrtekwagglyvdhsrgddtlavwtkqnreivnkdivmwhvvgihhvp
    aqedfpimpllstsfelrptnffernpvlktlsprdvawpgc