PDB entry 1w2x

View 1w2x on RCSB PDB site
Description: crystal structure of the carboxyltransferase domain of acetyl-coenzyme a carboxylase in complex with cp-640186
Class: transferase
Keywords: transferase, acetyl-coa carboxylase, carboxyltransferase, cp-640186, inhibitor, acc, ct, crystal structure
Deposited on 2004-07-09, released 2004-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w2xa1, d1w2xa2
  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w2xb1, d1w2xb2
  • Chain 'C':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w2xc1, d1w2xc2
  • Heterogens: RCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2xA (A:)
    gsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltdd
    ffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigs
    fgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqy
    lyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagat
    srayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnl
    qlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftp
    tndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigve
    trtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrg
    fsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemy
    advnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskql
    adrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeyl
    ikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa
    qdlakkirsdhdnaidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2xA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskele
    wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
    ieenyktlddklkglklesfaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2xB (B:)
    gsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltdd
    ffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigs
    fgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqy
    lyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagat
    srayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnl
    qlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftp
    tndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigve
    trtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrg
    fsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemy
    advnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskql
    adrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeyl
    ikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa
    qdlakkirsdhdnaidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2xB (B:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskele
    wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
    ieenyktlddklkglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w2xC (C:)
    gsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltdd
    ffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigs
    fgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqy
    lyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagat
    srayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnl
    qlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftp
    tndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigve
    trtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrg
    fsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemy
    advnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskql
    adrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeyl
    ikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa
    qdlakkirsdhdnaidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2xC (C:)
    wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
    everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
    rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
    ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
    svgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshl
    tavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegre
    tesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpn
    saetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevlkyg
    sfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepqgmv
    gikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskelewtearrfffw
    rlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktldd
    klkglk