PDB entry 1w2w

View 1w2w on RCSB PDB site
Description: crystal structure of yeast ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eif2b subunits
Deposited on 2004-07-09, released 2004-07-16
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-26, with a file datestamp of 2004-08-26.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.17436
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1w2w.1
  • Chain 'B':
    Domains in SCOP 1.69: d1w2w.1
  • Chain 'E':
    Domains in SCOP 1.69: d1w2w.2
  • Chain 'F':
    Domains in SCOP 1.69: d1w2w.2
  • Chain 'I':
    Domains in SCOP 1.69: d1w2w.3
  • Chain 'J':
    Domains in SCOP 1.69: d1w2w.3
  • Chain 'M':
    Domains in SCOP 1.69: d1w2w.4
  • Chain 'N':
    Domains in SCOP 1.69: d1w2w.4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2wA (A:)
    msleaivfdrsepenvsvkvldqlllpyttkyvpihtiddgysviksmqvrgapaiaivg
    slsvltevqlikhnptsdvatlyslvnwestktvlnkrldfllssrptavnlsnslveik
    nilksssdlkafdgslynyvcelidedlannmkmgdngakylidvlqkdgfkdefavlti
    cntgslatsgygtalgvirslwkdslaktdk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2wB (B:)
    cprmghvfpletrpynqgsrltayelvydkipstlitdssiayrirtspipikaafvgad
    rivrngdtankigtlqlavickqfgikffvvapkttidnvtetgddiiveernpeefkvv
    tgtvinpengslilnesgepitgkvgiapleinvwnpafditphelidgiiteegvftkn
    ssgefqleslf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2wE (E:)
    msleaivfdrsepenvsvkvldqlllpyttkyvpihtiddgysviksmqvrgapaiaivg
    slsvltevqlikhnptsdvatlyslvnwestktvlnkrldfllssrptavnlsnslveik
    nilksssdlkafdgslynyvcelidedlannmkmgdngakylidvlqkdgfkdefavlti
    cntgslatsgygtalgvirslwkdslaktdk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2wF (F:)
    cprmghvfpletrpynqgsrltayelvydkipstlitdssiayrirtspipikaafvgad
    rivrngdtankigtlqlavickqfgikffvvapkttidnvtetgddiiveernpeefkvv
    tgtvinpengslilnesgepitgkvgiapleinvwnpafditphelidgiiteegvftkn
    ssgefqleslf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2wI (I:)
    msleaivfdrsepenvsvkvldqlllpyttkyvpihtiddgysviksmqvrgapaiaivg
    slsvltevqlikhnptsdvatlyslvnwestktvlnkrldfllssrptavnlsnslveik
    nilksssdlkafdgslynyvcelidedlannmkmgdngakylidvlqkdgfkdefavlti
    cntgslatsgygtalgvirslwkdslaktdk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2wJ (J:)
    cprmghvfpletrpynqgsrltayelvydkipstlitdssiayrirtspipikaafvgad
    rivrngdtankigtlqlavickqfgikffvvapkttidnvtetgddiiveernpeefkvv
    tgtvinpengslilnesgepitgkvgiapleinvwnpafditphelidgiiteegvftkn
    ssgefqleslf
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1w2wM (M:)
    msleaivfdrsepenvsvkvldqlllpyttkyvpihtiddgysviksmqvrgapaiaivg
    slsvltevqlikhnptsdvatlyslvnwestktvlnkrldfllssrptavnlsnslveik
    nilksssdlkafdgslynyvcelidedlannmkmgdngakylidvlqkdgfkdefavlti
    cntgslatsgygtalgvirslwkdslaktdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2wM (M:)
    sleaivfdrsepenvsvkvldqlllpyttkyvpihtiddgysviksmqvrgapaiaivgs
    lsvltevqlikhnptsdvatlyslvnwestktvlnkrldfllssrptavnlsnslveikn
    ilksssdlkafdgslynyvcelidedlannmkmgdngakylidvlqkdgfkdefavltic
    ntgslatsgygtalgvirslwkdslaktdk
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2wN (N:)
    cprmghvfpletrpynqgsrltayelvydkipstlitdssiayrirtspipikaafvgad
    rivrngdtankigtlqlavickqfgikffvvapkttidnvtetgddiiveernpeefkvv
    tgtvinpengslilnesgepitgkvgiapleinvwnpafditphelidgiiteegvftkn
    ssgefqleslf