PDB entry 1w2u

View 1w2u on RCSB PDB site
Description: x-ray crystal structure of the catalytic domain of humicola grisea cel12a in complex with a soaked thio cellotetraose
Class: hydrolase
Keywords: hydrolase, cellulase, cellulose degradation, endoglucanase, glycosyl hydrolase, gh family 12, humicola grisea cel12a, ligand complex
Deposited on 2004-07-08, released 2004-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: HUMICOLA GRISEA [TaxId:5527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w2ua_
  • Heterogens: SO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2uA (A:)
    eirslcelygywsgngyellnnlwgkdtatsgwqctyldgtnnggiqwstawewqgapdn
    vksypyvgkqiqrgrkisdinsmrtsvswtydrtdiranvaydvftardpdhpnwggdye
    lmiwlaryggiypigtfhsqvnlagrtwdlwtgyngnmrvysflppsgdirdfscdikdf
    fnylernhgypareqnlivyqvgtecftggparftcrdfradlw