PDB entry 1w2t

View 1w2t on RCSB PDB site
Description: beta-fructosidase from thermotoga maritima in complex with raffinose
Class: hydrolase
Keywords: hydrolase, glycosidase, invertase, raffinose, beta fructosidase
Deposited on 2004-07-08, released 2005-10-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2T (0-0)
      • engineered mutation (189)
      • cloning artifact (107)
      • cloning artifact (178)
    • Uniprot O33833 (1-431)
    Domains in SCOPe 2.05: d1w2ta1, d1w2ta2
  • Chain 'B':
    Compound: beta fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2T (0-0)
      • engineered mutation (189)
      • cloning artifact (107)
      • cloning artifact (178)
    • Uniprot O33833 (1-431)
    Domains in SCOPe 2.05: d1w2tb1, d1w2tb2
  • Chain 'C':
    Compound: beta fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2T (0-0)
      • engineered mutation (189)
      • cloning artifact (107)
      • cloning artifact (178)
    • Uniprot O33833 (1-431)
    Domains in SCOPe 2.05: d1w2tc1, d1w2tc2
  • Chain 'D':
    Compound: beta fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2T (0-0)
      • engineered mutation (189)
      • cloning artifact (107)
      • cloning artifact (178)
    • Uniprot O33833 (1-431)
    Domains in SCOPe 2.05: d1w2td1, d1w2td2
  • Chain 'E':
    Compound: beta fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2T (0-0)
      • engineered mutation (189)
      • cloning artifact (107)
      • cloning artifact (178)
    • Uniprot O33833 (1-431)
    Domains in SCOPe 2.05: d1w2te1, d1w2te2
  • Chain 'F':
    Compound: beta fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2T (0-0)
      • engineered mutation (189)
      • cloning artifact (107)
      • cloning artifact (178)
    • Uniprot O33833 (1-431)
    Domains in SCOPe 2.05: d1w2tf1, d1w2tf2
  • Heterogens: CIT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2tA (A:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2tB (B:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2tC (C:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2tD (D:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2tE (E:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2tF (F:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl