PDB entry 1w2s

View 1w2s on RCSB PDB site
Description: solution structure of cr2 scr 1-2 in its complex with c3d by x-ray scattering
Class: immune system
Keywords: immune system, x-ray scattering, analytical ultracentrifugation, complement, thrombospondin type I repeats, constrained modelling, glycoprotein, immunology
Deposited on 2004-07-08, released 2005-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: SAXS
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement c3 precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2S (294-294)
      • conflict (16)
    • Uniprot P01024 (295-306)
    Domains in SCOPe 2.07: d1w2sa1, d1w2sa2
  • Chain 'B':
    Compound: complement receptor type 2 precursor,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2S (137-141)
      • conflict (66)
    • Uniprot P20023 (4-136)
    Domains in SCOPe 2.07: d1w2sb1, d1w2sb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2sA (A:)
    mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
    tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
    pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
    dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
    syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
    nldvslq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2sB (B:)
    eaeaiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwd
    kpapkcqyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqann
    mwgptrlptcvsvfpleqklis