PDB entry 1w2r

View 1w2r on RCSB PDB site
Description: solution structure of cr2 scr 1-2 by x-ray scattering
Class: immune system
Keywords: immune system, analytical ultracentrifugation, thrombospondin type I repeats, constrained modelling, glycoprotein
Deposited on 2004-07-08, released 2005-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: SAXS
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement receptor type 2 precursor,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2R (137-141)
      • conflict (66)
    • Uniprot P20023 (4-136)
    Domains in SCOPe 2.07: d1w2ra1, d1w2ra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2rA (A:)
    eaeaiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwd
    kpapkcqyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqann
    mwgptrlptcvsvfpleqklis