PDB entry 1w2q

View 1w2q on RCSB PDB site
Description: allergen arah6 from peanut (arachis hypogaea)
Deposited on 2004-07-08, released 2005-11-02
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conglutin
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2Q (126-126)
      • conflict (64-65)
      • conflict (70-71)
    • Uniprot Q8W251 (2-125)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1w2qA (A:)
    gpmrrergrqgdssscerqvdrvnlkpceqhimqrimgeqeqydsydirstrssdqqqrc
    cdelnementqgcmcealqqimenqcdrlqdrqmvqqfkrelmslpqqcnfrapqrcdld
    vsggrcs