PDB entry 1w2p

View 1w2p on RCSB PDB site
Description: the 3-dimensional structure of a xylanase (xyn10a) from cellvibrio japonicus
Class: hydrolase
Keywords: xylanase, calcium ion, thermostable, glycosyle hydrolase, family 10, error prone pcr, hydrolase
Deposited on 2004-07-07, released 2004-09-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.129
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase a precursor
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2P
    • Uniprot P14768 (346-End)
    Domains in SCOPe 2.04: d1w2pa_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase a precursor
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2P
    • Uniprot P14768 (346-End)
    Domains in SCOPe 2.04: d1w2pb_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2pA (A:)
    mglasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsf
    tnsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqv
    kswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyyn
    dfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalspt
    lkikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrr
    ggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2pA (A:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2pB (B:)
    mglasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsf
    tnsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqv
    kswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyyn
    dfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalspt
    lkikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrr
    ggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2pB (B:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg