PDB entry 1w2o

View 1w2o on RCSB PDB site
Description: deacetoxycephalosporin c synthase (with a n-terminal his-tag) in complex with fe(II) and deacetoxycephalosporin c
Class: oxidoreductase
Keywords: oxidoreductase, cephalosporin, penicillin, mononuclear ferrous enzymes, 2-oxoglutarate dependent oxygenases
Deposited on 2004-07-07, released 2004-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.276
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deacetoxycephalosporin c synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2O
    • Uniprot P18548 (20-End)
    Domains in SCOPe 2.07: d1w2oa_
  • Heterogens: FE, P1C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2oA (A:)
    mgsshhhhhhssglvprgshmdttvptfslaelqqglhqdefrrclrdkglfyltdcglt
    dtelksakdlvidffehgseaekravtspvptmrrgftglesestaqitntgsysdysmc
    ysmgtadnlfpsgdferiwtqyfdrqytasravarevlratgtepdggveafldcepllr
    fryfpqvpehrsaeeqplrmaphydlsmvtliqqtpcangfvslqaevggaftdlpyrpd
    avlvfcgaiatlvtggqvkaprhhvaaprrdqiagssrtssvfflrpnadftfsvplare
    cgfdvsldgetatfqdwiggnyvnirrtska
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2oA (A:)
    mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdlvidffehgse
    aekravtspvptmrrgftglesysmcysmgtadnlfpsgdferiwtqyfdrqytasrava
    revlratgtepdggveafldcepllrfryfpqvplrmaphydlsmvtliqqtpcangfvs
    lqaevggaftdlpyrpdavlvfcgaiatlvtggqvkaprhhvaaprrdqiagssrtssvf
    flrpnadftfsvplarecgfdvsldgetatfqdwig