PDB entry 1w2l

View 1w2l on RCSB PDB site
Description: cytochrome c domain of caa3 oxygen oxidoreductase
Class: oxidoreductase
Keywords: cytochrome c domain, oxidoreductase
Deposited on 2004-07-06, released 2005-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.1423
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome oxidase subunit II
    Species: Rhodothermus marinus [TaxId:29549]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2L
    • Uniprot Q9F3S9 (2-98)
    Domains in SCOPe 2.07: d1w2la_
  • Heterogens: HEM, TRS, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1w2lA (A:)
stmplaelgarlyrekacfschsidgsrlvgpsfkglygstrtfedgttavadenylres
ilqpgakvvqgypnvmpasyaslserevaaliefikqqq

    Sequence, based on observed residues (ATOM records): (download) 
    >1w2lA (A:)
mplaelgarlyrekacfschsidgsrlvgpsfkglygstrtfedgttavadenylresil
qpgakvvqgypnvmpasyaslserevaaliefikqqq