PDB entry 1w2i

View 1w2i on RCSB PDB site
Description: crystal structuore of acylphosphatase from pyrococcus horikoshii complexed with formate
Class: hydrolase
Keywords: hydrolase, thermophilic, stability, amyloid, phosphatase
Deposited on 2004-07-06, released 2004-08-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acylphosphatase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2I (Start-90)
    Domains in SCOPe 2.06: d1w2ia_
  • Chain 'B':
    Compound: acylphosphatase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2I (Start-90)
    Domains in SCOPe 2.06: d1w2ib_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2iA (A:)
    maivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealig
    wahqgpplarvtrvevkweqpkgekgfrivg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2iA (A:)
    aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
    ahqgpplarvtrvevkweqpkgekgfrivg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2iB (B:)
    maivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealig
    wahqgpplarvtrvevkweqpkgekgfrivg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2iB (B:)
    aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
    ahqgpplarvtrvevkweqpkgekgfrivg