PDB entry 1w2i

View 1w2i on RCSB PDB site
Description: crystal structuore of acylphosphatase from pyrococcus horikoshii complexed with formate
Deposited on 2004-07-06, released 2004-08-04
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-04, with a file datestamp of 2004-08-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16673
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1w2ia_
  • Chain 'B':
    Domains in SCOP 1.69: d1w2ib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2iA (A:)
    maivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealig
    wahqgpplarvtrvevkweqpkgekgfrivg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2iA (A:)
    aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
    ahqgpplarvtrvevkweqpkgekgfrivg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2iB (B:)
    maivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealig
    wahqgpplarvtrvevkweqpkgekgfrivg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2iB (B:)
    aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
    ahqgpplarvtrvevkweqpkgekgfrivg