PDB entry 1w2h

View 1w2h on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with azidothymidine monophosphate (azt-mp) (2.0 a resolution)
Class: transferase
Keywords: transferase, mycobacterium tuberculosis, thymidylate kinase, azt, inhibition mechanism, crystal structure
Deposited on 2004-07-06, released 2005-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.259
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase tmk
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2ha_
  • Chain 'B':
    Compound: thymidylate kinase tmk
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2hb_
  • Heterogens: ATM, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2hA (A:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
    elaaqgwggrwlvvgadvdpgrlaatlappdvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2hA (A:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagerdaelqqrtgavyaelaaqgwggrwlvvgadv
    dpgrlaatlap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2hB (B:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
    elaaqgwggrwlvvgadvdpgrlaatlappdvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2hB (B:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgardnyerdaelqqrtgavyaelaaqgwg
    grwlvvgadvdpgrlaatlap