PDB entry 1w2f

View 1w2f on RCSB PDB site
Description: human inositol (1,4,5)-trisphosphate 3-kinase substituted with selenomethionine
Class: transferase
Keywords: inositol phosphate kinase, transferase, calmodulin-binding
Deposited on 2004-07-01, released 2004-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.204
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inositol-trisphosphate 3-kinase a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2F (0-0)
      • conflict (1)
    • Uniprot P23677 (1-275)
    Domains in SCOPe 2.07: d1w2fa_
  • Chain 'B':
    Compound: inositol-trisphosphate 3-kinase a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W2F (0-0)
      • conflict (1)
    • Uniprot P23677 (1-275)
    Domains in SCOPe 2.07: d1w2fb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2fA (A:)
    mswvqlaghtgsfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesy
    lqlqdlldgfdgpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeeh
    aqravtkprymqwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqg
    deevlrrylnrlqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpd
    gqildhrrpweegnredgyllgldnligilaslaer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2fB (B:)
    mswvqlaghtgsfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesy
    lqlqdlldgfdgpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeeh
    aqravtkprymqwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqg
    deevlrrylnrlqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpd
    gqildhrrpweegnredgyllgldnligilaslaer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2fB (B:)
    mswvqlasfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlq
    dlldgfdgpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqra
    vtkprymqwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqgdeev
    lrrylnrlqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpdgqil
    dhrrpweegnredgyllgldnligilaslaer